teduglutide (gattex kit) Report issue

Biologics Peptide Orphan Drug FDA Approved FDA
AACT ChEMBL DrugBank Drug Central Drugs@FDA KEGG MeSH PubChem repoDB

Active Ingredient History

NOW
  • Now
Teduglutide is a glucagon-like peptide-2 (GLP-2) analogue. It is made up of 33 amino acids and is manufactured using a strain of Escherichia coli modified by recombinant DNA technology. Teduglutide differs from GLP-2 by one amino acid (alanine is substituted by glycine). The significance of this substitution is that teduglutide is longer acting than endogenous GLP-2 as it is more resistant to proteolysis from dipeptidyl peptidase-4. GLP-2 is known to increase intestinal and portal blood flow, and inhibit gastric acid secretion. Teduglutide binds to the glucagon-like peptide-2 receptors located in intestinal subpopulations of enteroendocrine cells, subepithelial myofibroblasts and enteric neurons of the submucosal and myenteric plexus. Activation of these receptors results in the local release of multiple mediators including insulin-like growth factor (IGF)-1, nitric oxide and keratinocyte growth factor (KGF). FDA approved on December 21, 2012. In Europe it has been granted orphan drug status and is marketed under the brand Revestive by Nycomed. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion.   NCATS

Chemistry

  • SMILES: CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H](NC(=O)[C@H](Cc3ccccc3)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H](N)Cc5c[nH]cn5)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O
  • InChIKey: CILIXQOJUNDIDU-ASQIGDHWSA-N
  • Mol. Mass: 3752.14
  • ALogP: Missing data
  • ChEMBL Molecule:
    teduglutide  
More Chemistry

Pharmacology

  • Mechanisms of Action:
  • Multi-specific: No
  • Black Box: No
  • Availability: Prescription Only
  • Delivery Methods: Parenteral
  • Pro Drug: No

Alternative names

alx 0600 | alx-0600 | gattex | gattex kit | glucagon-like peptide ii (2-glycine) (human) | (gly2)glp-2 | gly(2)-glp-2 | hgdgsfsdemntildnlaardfinwliqtkitd | his-gly-asp-gly-ser-phe-ser-asp-glu-met-asn-thr-ile-leu-asp-asn-leu-ala-ala-arg-asp-phe-ile-asn-trp-leu-ile-gln-thr-lys-ile-thr-asp | revestive | tedguglutide | teduglutide | teduglutide [rdna origin] | teduglutide recombinant

Organizations (20)

Research & Development (20)

Organization Org Type FDA approvals Clinical Trials involvement Org ID Force Sort

Marketing (2)

Organization Org Type FDA approvals Clinical Trials involvement Org ID Force Sort

Indications (12)

Approved Indications (1)


 

Short Bowel Syndrome

Experimental Indications - Clinical Trial Phases 1-4 (12)


 

Crohn Disease (Phase 2)

Graft vs Host Disease (Early Phase 1)

Healthy Volunteers (Phase 1)

HIV (Phase 2)

Hyperlipidemias (Phase 2/Phase 3)

Ileostomy (Phase 3)

Kidney Failure, Chronic (Phase 1)

Liver Diseases (Phase 1)

Pharmacokinetics (Phase 1)

Postoperative Complications (Phase 1)

Severe Acute Malnutrition (Phase 2)

Short Bowel Syndrome ()

Overview

  • Highest Phase: Phase 4
  • # of Trials: 35
  • # of Trial Organizations: 20

Trials by Phase

Trial Phase Start Date Organizations Indications

Feedback

Data collection and curation is an ongoing process for CDEK - if you notice any information here to be missing or incorrect, please let us know! When possible, please include a source URL (we verify all data prior to inclusion).

Report issue